dbPTM

MMS2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MMS2_SCHPO
UniProt AC	O74983
Protein Name	Ubiquitin-conjugating enzyme spm2
Gene Name	spm2
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	139
Subcellular Localization
Protein Description	Has a role in the DNA error-free postreplication repair (PRR) pathway. Lacks catalytic activity by itself. The ubc13/spm2 heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'..
Protein Sequence	MAKVPRNFKLLEELEKGEKGLGESSCSYGLTNADDITLSDWNATILGPAHSVHENRIYSLKIHCDANYPDAPPIVTFVSRINLPGVDGETGKVNPHKIDCLRHWKREYSMETVLLDLKKEMASSSNRKLPQPPEGSTFF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MMS2_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MMS2_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MMS2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MMS2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
UBC13_SCHPO	ubc13	physical	16641370
UBC13_SCHPO	ubc13	physical	12531016

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MMS2_SCHPO

Related Literatures of Post-Translational Modification