| UniProt ID | MLRA_HUMAN | |
|---|---|---|
| UniProt AC | Q01449 | |
| Protein Name | Myosin regulatory light chain 2, atrial isoform | |
| Gene Name | MYL7 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 175 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MASRKAGTR ------CCCCCCCCC | 20.31 | - | |
| 22 | Phosphorylation | TKQAQRGSSNVFSMF HHHHHCCCCCHHHHH | 22.41 | 26657352 | |
| 23 | Phosphorylation | KQAQRGSSNVFSMFE HHHHCCCCCHHHHHH | 39.58 | 26657352 | |
| 27 | Phosphorylation | RGSSNVFSMFEQAQI CCCCCHHHHHHHHHH | 20.48 | 26657352 | |
| 109 | Phosphorylation | DPEEAILSAFRMFDP CHHHHHHHHHHHCCC | 21.17 | 24719451 | |
| 119 | Acetylation | RMFDPSGKGVVNKDE HHCCCCCCCCCCHHH | 53.52 | 30590609 | |
| 150 | Phosphorylation | VEQMFALTPMDLAGN HHHHHCCCCCHHCCC | 17.09 | 29978859 | |
| 165 | Phosphorylation | IDYKSLCYIITHGDE CCHHHEEEEEECCCC | 10.72 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MLRA_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MLRA_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MLRA_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MLRA_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...