dbPTM

MLP31_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MLP31_ARATH
UniProt AC	Q941R6
Protein Name	MLP-like protein 31
Gene Name	MLP31
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	171
Subcellular Localization
Protein Description
Protein Sequence	MATKMAGAAMNLAKRESSSLCGKLETDIEIKASAGKFHHMFAGRPHHVSKATPGKIQGCELHEGDWGKVGSIVFWNYVHDGEAKVAKERIEAVEPEKNLITFRVIEGDLLKEYKSFVITIQVTPKRGGPGSVVHWHVEYEKIDDKVAHPETFLDFCVEVSKEIDEHLLNEE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
115	Phosphorylation	DLLKEYKSFVITIQV HHHHHEEEEEEEEEE	24.68	28295753
123	Phosphorylation	FVITIQVTPKRGGPG EEEEEEECCCCCCCC	13.50	28295753

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MLP31_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MLP31_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MLP31_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MLP31_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MLP31_ARATH

Related Literatures of Post-Translational Modification