ML423_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ML423_ARATH
• UniProt AC: Q93VR4
• Protein Name: MLP-like protein 423
• Gene Name: MLP423
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 155
• Protein Sequence: MGLSGVLHVEVEVKSPAEKFWVALGDGINLFPKAFPNDYKTIQVLAGDGNAPGSIRLITYGEGSPLVKISAERIEAVDLENKSMSYSIIGGEMLEYYKTFKGTITVIPKDGGSLLKWSGEFEKTAHEIDDPHVIKDFAVKNFKEIDEYLLKQTSA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
64	Phosphorylation	LITYGEGSPLVKISA EEEECCCCCEEEEEH	15.68	19880383
118	Phosphorylation	GGSLLKWSGEFEKTA CCCEEEEEECCEECE	27.19	19880383
153	Phosphorylation	DEYLLKQTSA----- HHHHHHHCCC-----	25.65	19880383
154	Phosphorylation	EYLLKQTSA------ HHHHHHCCC------	29.50	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ML423_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ML423_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ML423_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of ML423_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.