ML328_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ML328_ARATH
• UniProt AC: Q9ZVF3
• Protein Name: MLP-like protein 328
• Gene Name: MLP328
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 151
• Protein Sequence: MATSGTYVTEVPLKGSAEKHYKRWRSENHLFPDAIGHHIQGVTIHDGEWDSHGAIKIWNYTCDGKPEVFKERREIDDENMAVTFRGLEGHVMEQLKVYDVIFQFIQKSPDDIICKITMIWEKQNDDMPEPSNYMKFVKSLAADMDDHVLKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MATSGTYVTE -----CCCCCEEEEE	26.79	30407730
4	Phosphorylation	----MATSGTYVTEV ----CCCCCEEEEEE	21.43	30407730
6	Phosphorylation	--MATSGTYVTEVPL --CCCCCEEEEEEEC	18.00	30407730
7	Phosphorylation	-MATSGTYVTEVPLK -CCCCCEEEEEEECC	14.65	19880383
9	Phosphorylation	ATSGTYVTEVPLKGS CCCCEEEEEEECCCC	22.35	30407730
16	Phosphorylation	TEVPLKGSAEKHYKR EEEECCCCHHHHHHH	31.50	30407730
139	Phosphorylation	NYMKFVKSLAADMDD HHHHHHHHHHHCCCC	20.24	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ML328_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ML328_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ML328_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of ML328_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.