UniProt ID | ML12B_RAT | |
---|---|---|
UniProt AC | P18666 | |
Protein Name | Myosin regulatory light chain 12B | |
Gene Name | Myl12b | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 172 | |
Subcellular Localization | ||
Protein Description | Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Phosphorylation triggers actin polymerization in vascular smooth muscle. Implicated in cytokinesis, receptor capping, and cell locomotion.. | |
Protein Sequence | MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGRINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | KKRPQRATSNVFAMF CCCCCHHHHHHHHHC | 24.03 | 11384979 | |
20 | Phosphorylation | KRPQRATSNVFAMFD CCCCHHHHHHHHHCC | 29.97 | 11384979 | |
29 | Phosphorylation | VFAMFDQSQIQEFKE HHHHCCHHHHHHHHH | 30.97 | 28689409 | |
51 | Acetylation | NRDGFIDKEDLHDML CCCCCCCHHHHHHHH | 48.59 | 72626221 | |
135 | Phosphorylation | TTMGDRFTDEEVDEL HHCCCCCCHHHHHHH | 43.31 | 30181290 | |
156 | Phosphorylation | DKKGNFNYIEFTRIL CCCCCCCCEEHHHHH | 9.55 | 27097102 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
19 | T | Phosphorylation | Kinase | MYLK | D3ZFU9 | GPS |
19 | T | Phosphorylation | Kinase | DAPK3 | O88764 | Uniprot |
19 | T | Phosphorylation | Kinase | PRKACA | P00517 | GPS |
19 | T | Phosphorylation | Kinase | MLCK | - | Uniprot |
20 | S | Phosphorylation | Kinase | DAPK3 | O88764 | Uniprot |
20 | S | Phosphorylation | Kinase | PRKACA | P00517 | GPS |
20 | S | Phosphorylation | Kinase | MYLK | Q15746 | GPS |
20 | S | Phosphorylation | Kinase | MLCK | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ML12B_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ML12B_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ML12B_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...