MK_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MK_MOUSE
• UniProt AC: P12025
• Protein Name: Midkine
• Gene Name: Mdk
• Organism: Mus musculus (Mouse).
• Sequence Length: 140
• Subcellular Localization: Secreted .
• Protein Description: Developmentally regulated, secreted growth factor homologous to pleiotrophin (PTN), which has heparin binding activity. Binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1), followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase, and the induction of cell proliferation (By similarity). Involved in neointima formation after arterial injury, possibly by mediating leukocyte recruitment. Also involved in early fetal adrenal gland development..
• Protein Sequence: MQHRGFFLLALLALLVVTSAVAKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
127	Phosphorylation	TKPCTSKTKSKTKAK CCCCCCCCCCCCCCC	40.07	20139300

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MK_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MK_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MK_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of MK_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.