MK01_XENLA - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MK01_XENLA
• UniProt AC: P26696
• Protein Name: Mitogen-activated protein kinase 1
• Gene Name: mapk1
• Organism: Xenopus laevis (African clawed frog).
• Sequence Length: 361
• Subcellular Localization: Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm . Cytoplasm, cytoskeleton, spindle . Associated with the spindle during prometaphase and metaphase in cultured XTC cells.
• Protein Description: Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. Plays an important role in the MAPK/ERK cascade. Depending on the cellular context, this cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. Many of the substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. Phosphorylates microtubule-associated protein 2 (MAP2), myelin basic protein (MBP) and Elk-1. Phosphorylates dual specificity protein phosphatase 1 (DUSP1) during meiosis, increasing its stability. Activated by M phase promoting factor (MPF). Plays a role in the spindle assembly checkpoint..
• Protein Sequence: MAAAGAASNPGGGPEMVRGQAFDVGPRYINLAYIGEGAYGMVCSAHDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEAALAHPYLEQYYDPSDEPVAEAPFKFEMELDDLPKETLKELIFEETARFQPGY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
188	Phosphorylation	HDHTGFLTEYVATRW CCCCCHHHHHHHHCC	24.02	1313186
190	Phosphorylation	HTGFLTEYVATRWYR CCCHHHHHHHHCCCC	7.08	1313186

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MK01_XENLA !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MK01_XENLA !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MK01_XENLA !!

Protein-Protein Interaction

Oops, there are no PPI records of MK01_XENLA !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Requirements for phosphorylation of MAP kinase during meiosis inXenopus oocytes.";
Posada J., Cooper J.A.;
Science 255:212-215(1992).
Cited for: PHOSPHORYLATION AT THR-188 AND TYR-190, MUTAGENESIS OF LYS-57; ILE-86;THR-188 AND TYR-190, AND ENZYME REGULATION.
PubMed: 1313186