UniProt ID | MGST3_MOUSE | |
---|---|---|
UniProt AC | Q9CPU4 | |
Protein Name | Microsomal glutathione S-transferase 3 | |
Gene Name | Mgst3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 153 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Microsome membrane Multi-pass membrane protein . Microsome membrane Lipid-anchor . |
|
Protein Description | Also functions as a glutathione peroxidase.. | |
Protein Sequence | MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRAHQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIIGRVLYAYGYYTGDPSKRYRGAVGSLALFALMGTTVCSAFQHLGWIRPGLGYGSRSCHH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
37 | Ubiquitination | GKARKKYKVEYPVMY CHHCCCEEEEEEEEE | 37.15 | 22790023 | |
56 | S-nitrosocysteine | ENGHMFNCIQRAHQN CCCCCCHHHHHHHHC | 1.59 | - | |
56 | Glutathionylation | ENGHMFNCIQRAHQN CCCCCCHHHHHHHHC | 1.59 | 24333276 | |
56 | S-nitrosylation | ENGHMFNCIQRAHQN CCCCCCHHHHHHHHC | 1.59 | 21278135 | |
56 | S-palmitoylation | ENGHMFNCIQRAHQN CCCCCCHHHHHHHHC | 1.59 | 28680068 | |
111 | Acetylation | YYTGDPSKRYRGAVG CCCCCCCHHCCHHHH | 59.86 | 15613451 | |
151 | S-palmitoylation | LGYGSRSCHH----- CCCCCCCCCC----- | 3.09 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MGST3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MGST3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MGST3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MGST3_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...