dbPTM

MGDP1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MGDP1_SCHPO
UniProt AC	O94279
Protein Name	Putative magnesium-dependent phosphatase P8B7.31
Gene Name	SPBP8B7.31
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	172
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Magnesium-dependent phosphatase which may act as a tyrosine phosphatase..
Protein Sequence	MVKNIEFPKCVVFDLDYTLWPLWIDTHVTAPFKPSKNDPGVLIDKYGTEICFYSDITGILQELRNQKVTLCVASRTCAPKYAKQALNLMKVPIDGSLKPAIEFFTYVKAWPGSKMDHFKEIHNESGIDYREMVFFDDESRNREVERLGVTFLEKIKKNSLNILSFLKNHMHG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MGDP1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MGDP1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MGDP1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MGDP1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PROB_SCHPO	SPAC17H9.13c	genetic	22681890
BCS1_SCHPO	SPAC644.07	genetic	22681890
SUM2_SCHPO	sum2	genetic	22681890
UBP2_SCHPO	ubp2	genetic	22681890
YI43_SCHPO	SPBC1348.03	genetic	22681890
RCD1_SCHPO	rcd1	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MGDP1_SCHPO

Related Literatures of Post-Translational Modification