UniProt ID | MGDP1_SCHPO | |
---|---|---|
UniProt AC | O94279 | |
Protein Name | Putative magnesium-dependent phosphatase P8B7.31 | |
Gene Name | SPBP8B7.31 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 172 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.. | |
Protein Sequence | MVKNIEFPKCVVFDLDYTLWPLWIDTHVTAPFKPSKNDPGVLIDKYGTEICFYSDITGILQELRNQKVTLCVASRTCAPKYAKQALNLMKVPIDGSLKPAIEFFTYVKAWPGSKMDHFKEIHNESGIDYREMVFFDDESRNREVERLGVTFLEKIKKNSLNILSFLKNHMHG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of MGDP1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MGDP1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MGDP1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MGDP1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PROB_SCHPO | SPAC17H9.13c | genetic | 22681890 | |
BCS1_SCHPO | SPAC644.07 | genetic | 22681890 | |
SUM2_SCHPO | sum2 | genetic | 22681890 | |
UBP2_SCHPO | ubp2 | genetic | 22681890 | |
YI43_SCHPO | SPBC1348.03 | genetic | 22681890 | |
RCD1_SCHPO | rcd1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...