| UniProt ID | MG101_SCHPO | |
|---|---|---|
| UniProt AC | O14354 | |
| Protein Name | Mitochondrial genome maintenance protein mgm101 | |
| Gene Name | mgm101 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 270 | |
| Subcellular Localization | Mitochondrion matrix, mitochondrion nucleoid . | |
| Protein Description | Performs an essential function in the repair of oxidatively damaged mtDNA that is required for the maintenance of the mitochondrial genome. Binds to DNA (By similarity).. | |
| Protein Sequence | MQTMLGKPALQYFGKLSRYLYKNGEPINIWVYSRNSSFSVIPKNGLLSPKITQRFYQNSSIQYQKDKNIYEPKENLEEKELSEGFLDESRLEIPEAGHNWEKSFFGLSSQPFSKEICDLLTAPLEVDDIEIKPDGILYLPEIKYRRILNKAFGPGGWGLAPRGNTNVTSKSVSREYALVCHGRLVSVARGEQTYFDPEGIATASEGCKSNALMRCCKDLGVASELWDPRYIRVFKRENCVEVFVENVLTKKRRKLWRRKEDKFSYPYKEV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 82 | Phosphorylation | NLEEKELSEGFLDES CCCHHHHHCCCCCHH | 7.34 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MG101_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MG101_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MG101_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MG101_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...