MG101_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MG101_SCHPO
• UniProt AC: O14354
• Protein Name: Mitochondrial genome maintenance protein mgm101
• Gene Name: mgm101
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 270
• Subcellular Localization: Mitochondrion matrix, mitochondrion nucleoid .
• Protein Description: Performs an essential function in the repair of oxidatively damaged mtDNA that is required for the maintenance of the mitochondrial genome. Binds to DNA (By similarity)..
• Protein Sequence: MQTMLGKPALQYFGKLSRYLYKNGEPINIWVYSRNSSFSVIPKNGLLSPKITQRFYQNSSIQYQKDKNIYEPKENLEEKELSEGFLDESRLEIPEAGHNWEKSFFGLSSQPFSKEICDLLTAPLEVDDIEIKPDGILYLPEIKYRRILNKAFGPGGWGLAPRGNTNVTSKSVSREYALVCHGRLVSVARGEQTYFDPEGIATASEGCKSNALMRCCKDLGVASELWDPRYIRVFKRENCVEVFVENVLTKKRRKLWRRKEDKFSYPYKEV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
82	Phosphorylation	NLEEKELSEGFLDES CCCHHHHHCCCCCHH	7.34	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MG101_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MG101_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MG101_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of MG101_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.