MFS1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MFS1_SCHPO
• UniProt AC: Q10487
• Protein Name: Transporter mfs1
• Gene Name: mfs1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 531
• Subcellular Localization: Endoplasmic reticulum . Membrane ; Multi-pass membrane protein .
• Protein Sequence: MWFLRETIFGELVEYFSGGTRQVDVEKLGVCTDNSNVELSSCPDSSFDDEKTNQVNSEGLIIVTWDGEDDPENPKNWPLWAKLVVTFDVCFLTFAVYMGSAIFTPGIQEIRETMHVGTVPVILGLTLFVEGYAVGPLIFSPLSEVPQIGRQKIYVLSLIVFICLQIPTALGSSLGVLLPMRFLAGVFGSPALSTGGASLADIWQPWLYPYFMCFWSLGAVGGPVLGPLLGAAMVVAKSWRWQFWLLMMISALVLVIITFFMPETSEWHLLYKRAKRLRELTGNPNYKTEAEIASSQLSKGQFAKQILVRPIILCVSEPIVLSLTIYIGLVYSILYLWFEAFPILFTTVYHFTTIENGLVYMGILVGSVLTVAFYFIYLRKVMIPKFVENKGKFPAEEILIISFPAAFFIPISLFWFGWTGRESVHWIVPIVGTLFYASGSFLLFQSMFQYLAAAYPKYVASVFAGNALFRSSMAAASPLYARAMFNNTGPSYAPVGWGSTILGVISCIMIPIPFLIYKWGLKLRSRSKYAT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
486	N-linked_Glycosylation	LYARAMFNNTGPSYA HHHHHHHCCCCCCCC	31.88	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MFS1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MFS1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MFS1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CAF5_SCHPO	caf5	genetic	22840777

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.