MFRN2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MFRN2_HUMAN
• UniProt AC: Q96A46
• Protein Name: Mitoferrin-2
• Gene Name: SLC25A28
• Organism: Homo sapiens (Human).
• Sequence Length: 364
• Subcellular Localization: Mitochondrion inner membrane ; Multi-pass membrane protein . Isoform 1 and isoform 2 are both localized in the mitochondrion.
• Protein Description: Mitochondrial iron transporter that mediates iron uptake. Probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme (By similarity)..
• Protein Sequence: MELEGRGAGGVAGGPAAGPGRSPGESALLDGWLQRGVGRGAGGGEAGACRPPVRQDPDSGPDYEALPAGATVTTHMVAGAVAGILEHCVMYPIDCVKTRMQSLQPDPAARYRNVLEALWRIIRTEGLWRPMRGLNVTATGAGPAHALYFACYEKLKKTLSDVIHPGGNSHIANGAAGCVATLLHDAAMNPAEVVKQRMQMYNSPYHRVTDCVRAVWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSHVLSGACAGAVAAAATTPLDVCKTLLNTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFKYLITKRQEEWRAGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Methylation	--MELEGRGAGGVAG --CCCCCCCCCCCCC	23.55	115917073
22	Phosphorylation	PAAGPGRSPGESALL CCCCCCCCCCHHHCH	43.08	22199227
26	Phosphorylation	PGRSPGESALLDGWL CCCCCCHHHCHHHHH	30.08	22199227
39	Methylation	WLQRGVGRGAGGGEA HHHCCCCCCCCCCCC	29.40	54559367
334	Phosphorylation	GVQARVIYQIPSTAI CEEEEEEEECCCHHH	9.49	22817900
346	Phosphorylation	TAIAWSVYEFFKYLI HHHHHHHHHHHHHHH	11.08	22817900
351	Phosphorylation	SVYEFFKYLITKRQE HHHHHHHHHHHHHHH	9.74	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MFRN2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MFRN2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MFRN2_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of MFRN2_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.