dbPTM

MFM1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MFM1_SCHPO
UniProt AC	P34068
Protein Name	M-factor
Gene Name	mfm1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	42
Subcellular Localization	Cell membrane Lipid-anchor Cytoplasmic side .
Protein Description	M-factor is a mating pheromone produced by M-type mating cells. All three mfm genes contribute to the production of M-factor..
Protein Sequence	MDSMANSVSSSSVVNAGNKPAETLNKTVKNYTPKVPYMCVIA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
39	Farnesylation	TPKVPYMCVIA---- CCCCCEEEEEC----	1.33	1547790
39	Farnesylation	TPKVPYMCVIA---- CCCCCEEEEEC----	1.33	1547790
39	Methylation	TPKVPYMCVIA---- CCCCCEEEEEC----	1.33	1547790

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MFM1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MFM1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MFM1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MFM1_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MFM1_SCHPO

Related Literatures of Post-Translational Modification

Methylation
Reference	PubMed
"Mating pheromones of the fission yeast Schizosaccharomyces pombe:purification and structural characterization of M-factor and isolationand analysis of two genes encoding the pheromone."; Davey J.; EMBO J. 11:951-960(1992). Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], PROTEIN SEQUENCE OF 31-39,ISOPRENYLATION AT CYS-39, AND METHYLATION AT CYS-39.	1547790 [Abstract]
Prenylation
Reference	PubMed
"Mating pheromones of the fission yeast Schizosaccharomyces pombe:purification and structural characterization of M-factor and isolationand analysis of two genes encoding the pheromone."; Davey J.; EMBO J. 11:951-960(1992). Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], PROTEIN SEQUENCE OF 31-39,ISOPRENYLATION AT CYS-39, AND METHYLATION AT CYS-39.	1547790 [Abstract]