| UniProt ID | MFAP3_RAT | |
|---|---|---|
| UniProt AC | Q6AYF7 | |
| Protein Name | Microfibril-associated glycoprotein 3 | |
| Gene Name | Mfap3 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 347 | |
| Subcellular Localization |
Cell membrane Single-pass type I membrane protein . |
|
| Protein Description | Component of the elastin-associated microfibrils.. | |
| Protein Sequence | MKLHYCLCILLVVTFVPTALVLEDVTPLGTNQSSYNASFLSSFELSAGSYSGDDVIIAKEGTNVSLECLLTVDHYGEVHWYNSKGRQLHSRGGKWLVSDNFLNITSVAFDDRGLYTCIITSPTRASYSVTLRVIFTSGDMSVYYMVVCLIAFTITLILNVTRLCLMSTHLRKTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARSVPLPPLILNCRAFVEEMFEAVRVDDPDDMGERIKERPALDAQSGIYVINPELGRSNSPGGDSDDGSLSEQGQEIAVQVSVHLQSETKSIGTDSQDSSHFSPPSDPASAEGSTHHRE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 31 | N-linked_Glycosylation | DVTPLGTNQSSYNAS CCCCCCCCCCCCCCC | 37.63 | - | |
| 36 | N-linked_Glycosylation | GTNQSSYNASFLSSF CCCCCCCCCCEECEE | 30.93 | - | |
| 63 | N-linked_Glycosylation | IIAKEGTNVSLECLL EEECCCCCEEEEEEE | 32.03 | - | |
| 103 | N-linked_Glycosylation | LVSDNFLNITSVAFD EEECCCCCEEEEEEC | 31.21 | - | |
| 105 | Phosphorylation | SDNFLNITSVAFDDR ECCCCCEEEEEECCC | 18.97 | 28689409 | |
| 116 | Phosphorylation | FDDRGLYTCIITSPT ECCCCEEEEEEECCC | 11.41 | 28689409 | |
| 120 | Phosphorylation | GLYTCIITSPTRASY CEEEEEEECCCCCCE | 14.56 | 28689409 | |
| 121 | Phosphorylation | LYTCIITSPTRASYS EEEEEEECCCCCCEE | 17.54 | 28689409 | |
| 126 | Phosphorylation | ITSPTRASYSVTLRV EECCCCCCEEEEEEE | 18.04 | 28689409 | |
| 191 | Ubiquitination | EGAEKLQKAFEIAKR HHHHHHHHHHHHHHH | 66.53 | - | |
| 274 | Phosphorylation | RPALDAQSGIYVINP CCCCCCCCCEEEECH | 28.95 | 27097102 | |
| 277 | Phosphorylation | LDAQSGIYVINPELG CCCCCCEEEECHHHC | 9.98 | 23984901 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MFAP3_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MFAP3_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MFAP3_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MFAP3_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
