UniProt ID | MET7B_MOUSE | |
---|---|---|
UniProt AC | Q9DD20 | |
Protein Name | Methyltransferase-like protein 7B | |
Gene Name | Mettl7b | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 244 | |
Subcellular Localization | ||
Protein Description | Probable methyltransferase.. | |
Protein Sequence | MDALVLFLQLLVLLLTLPLHLLALLGCWQPICKTYFPYFMAMLTARSYKKMESKKRELFSQIKDLKGTSGNVALLELGCGTGANFQFYPQGCKVTCVDPNPNFEKFLTKSMAENRHLQYERFIVAYGENMKQLADSSMDVVVCTLVLCSVQSPRKVLQEVQRVLRPGGLLFFWEHVAEPQGSRAFLWQRVLEPTWKHIGDGCHLTRETWKDIERAQFSEVQLEWQPPPFRWLPVGPHIMGKAVK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
55 | Ubiquitination | YKKMESKKRELFSQI HHHHHHHHHHHHHHH | 61.45 | 27667366 | |
63 | Acetylation | RELFSQIKDLKGTSG HHHHHHHHHHCCCCC | 49.74 | 23954790 | |
63 | Ubiquitination | RELFSQIKDLKGTSG HHHHHHHHHHCCCCC | 49.74 | 27667366 | |
63 | Malonylation | RELFSQIKDLKGTSG HHHHHHHHHHCCCCC | 49.74 | 26320211 | |
66 | Ubiquitination | FSQIKDLKGTSGNVA HHHHHHHCCCCCCEE | 70.99 | 22790023 | |
96 | S-palmitoylation | PQGCKVTCVDPNPNF CCCCEEEEECCCCCH | 3.51 | 28526873 | |
105 | Ubiquitination | DPNPNFEKFLTKSMA CCCCCHHHHHHHHHH | 41.35 | 22790023 | |
109 | Malonylation | NFEKFLTKSMAENRH CHHHHHHHHHHHHHC | 40.14 | 26320211 | |
109 | Ubiquitination | NFEKFLTKSMAENRH CHHHHHHHHHHHHHC | 40.14 | 27667366 | |
109 | Acetylation | NFEKFLTKSMAENRH CHHHHHHHHHHHHHC | 40.14 | 23954790 | |
155 | Malonylation | CSVQSPRKVLQEVQR HCCCCHHHHHHHHHH | 51.16 | 26320211 | |
155 | Ubiquitination | CSVQSPRKVLQEVQR HCCCCHHHHHHHHHH | 51.16 | 27667366 | |
196 | Malonylation | RVLEPTWKHIGDGCH HHHCCHHHCCCCCCE | 28.02 | 26320211 | |
196 | Ubiquitination | RVLEPTWKHIGDGCH HHHCCHHHCCCCCCE | 28.02 | - | |
202 | S-palmitoylation | WKHIGDGCHLTRETW HHCCCCCCEECHHHH | 2.57 | 26165157 | |
210 | Acetylation | HLTRETWKDIERAQF EECHHHHHHHHHHCC | 57.14 | 23201123 | |
210 | Malonylation | HLTRETWKDIERAQF EECHHHHHHHHHHCC | 57.14 | 26320211 | |
210 | Ubiquitination | HLTRETWKDIERAQF EECHHHHHHHHHHCC | 57.14 | 27667366 | |
218 | Phosphorylation | DIERAQFSEVQLEWQ HHHHHCCCEEEEEEC | 25.44 | 23140645 | |
230 | Methylation | EWQPPPFRWLPVGPH EECCCCCCCCCCCCC | 39.53 | 2617605 | |
230 | Dimethylation | EWQPPPFRWLPVGPH EECCCCCCCCCCCCC | 39.53 | - | |
241 | Ubiquitination | VGPHIMGKAVK---- CCCCCCCCCCC---- | 32.40 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MET7B_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MET7B_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MET7B_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MET7B_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...