UniProt ID | MET7B_HUMAN | |
---|---|---|
UniProt AC | Q6UX53 | |
Protein Name | Methyltransferase-like protein 7B | |
Gene Name | METTL7B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 244 | |
Subcellular Localization | ||
Protein Description | Probable methyltransferase.. | |
Protein Sequence | MDILVPLLQLLVLLLTLPLHLMALLGCWQPLCKSYFPYLMAVLTPKSNRKMESKKRELFSQIKGLTGASGKVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYERFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | QLLVLLLTLPLHLMA HHHHHHHHHHHHHHH | 26.71 | - | |
44 | Phosphorylation | PYLMAVLTPKSNRKM HHHHHHHCCCCCCCC | 23.28 | - | |
63 | Ubiquitination | RELFSQIKGLTGASG HHHHHHHHHHHCCCC | 39.98 | 33845483 | |
105 | Ubiquitination | DPNPHFEKFLTKSMA CCCHHHHHHHCHHHH | 44.74 | 33845483 | |
108 | Phosphorylation | PHFEKFLTKSMAENR HHHHHHHCHHHHHHH | 24.98 | - | |
109 | Ubiquitination | HFEKFLTKSMAENRH HHHHHHCHHHHHHHC | 40.14 | 33845483 | |
110 | Phosphorylation | FEKFLTKSMAENRHL HHHHHCHHHHHHHCC | 20.28 | - | |
241 | Ubiquitination | VGPHIMGKAVK---- CCCCCCCCCCC---- | 32.40 | 33845483 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MET7B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MET7B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MET7B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MET7B_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...