| UniProt ID | MET7A_HUMAN | |
|---|---|---|
| UniProt AC | Q9H8H3 | |
| Protein Name | Methyltransferase-like protein 7A | |
| Gene Name | METTL7A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 244 | |
| Subcellular Localization | Lipid droplet . Endoplasmic reticulum . Membrane . | |
| Protein Description | Probable methyltransferase.. | |
| Protein Sequence | MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MELTIFILRLA ----CCHHHHHHHHH | 10.67 | 20068231 | |
| 34 | Ubiquitination | LWSWICKKWFPYFLV HHHHHHHHHHHHHHH | 50.05 | 21890473 | |
| 47 | Phosphorylation | LVRFTVIYNEQMASK HHHHHHHCCHHHHHH | 14.33 | 22673903 | |
| 53 | Phosphorylation | IYNEQMASKKRELFS HCCHHHHHHHHHHHH | 33.11 | 22673903 | |
| 54 | Acetylation | YNEQMASKKRELFSN CCHHHHHHHHHHHHH | 46.44 | 24886945 | |
| 55 | Ubiquitination | NEQMASKKRELFSNL CHHHHHHHHHHHHHH | 48.92 | - | |
| 60 | Phosphorylation | SKKRELFSNLQEFAG HHHHHHHHHHHHHHC | 49.62 | 27499020 | |
| 69 | Phosphorylation | LQEFAGPSGKLSLLE HHHHHCCCCCEEEEE | 47.87 | 28857561 | |
| 71 | Ubiquitination | EFAGPSGKLSLLEVG HHHCCCCCEEEEEEC | 38.96 | - | |
| 86 | Ubiquitination | CGTGANFKFYPPGCR CCCCCCCEECCCCCE | 43.74 | - | |
| 105 | Ubiquitination | DPNPNFEKFLIKSIA CCCCCHHHHHHHHHH | 41.13 | 21890473 | |
| 109 | Acetylation | NFEKFLIKSIAENRH CHHHHHHHHHHHCCC | 37.65 | 20167786 | |
| 109 | Ubiquitination | NFEKFLIKSIAENRH CHHHHHHHHHHHCCC | 37.65 | 21890473 | |
| 210 | Acetylation | NLTRESWKALERASF CCCHHHHHHHHHHCC | 52.99 | 27452117 | |
| 216 | Phosphorylation | WKALERASFSKLKLQ HHHHHHHCCCHHCCC | 35.95 | 24719451 | |
| 218 | Phosphorylation | ALERASFSKLKLQHI HHHHHCCCHHCCCCC | 34.28 | 24719451 | |
| 219 | 2-Hydroxyisobutyrylation | LERASFSKLKLQHIQ HHHHCCCHHCCCCCC | 47.86 | - | |
| 219 | Ubiquitination | LERASFSKLKLQHIQ HHHHCCCHHCCCCCC | 47.86 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MET7A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MET7A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MET7A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MET7A_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
