UniProt ID | MET27_HUMAN | |
---|---|---|
UniProt AC | Q8N6F8 | |
Protein Name | Methyltransferase-like protein 27 {ECO:0000312|HGNC:HGNC:19068} | |
Gene Name | METTL27 {ECO:0000312|HGNC:HGNC:19068} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 245 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPELHVTKPGGLVCLTTRTNSSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWRWYPASLPRMASSPALSTCTESGRRPRLRK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Ubiquitination | GIPDLAQKLHFYDRW CCCHHHHHHCCHHCC | 21906983 | ||
214 | Phosphorylation | AGSWLPPSWRWYPAS CCCCCCCCCCCCCCC | 26091039 | ||
221 | Phosphorylation | SWRWYPASLPRMASS CCCCCCCCCCCCCCC | 24719451 | ||
227 | Phosphorylation | ASLPRMASSPALSTC CCCCCCCCCCCHHHC | 22210691 | ||
228 | Phosphorylation | SLPRMASSPALSTCT CCCCCCCCCCHHHCC | 22210691 | ||
232 | Phosphorylation | MASSPALSTCTESGR CCCCCCHHHCCCCCC | 22210691 | ||
233 | Phosphorylation | ASSPALSTCTESGRR CCCCCHHHCCCCCCC | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MET27_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MET27_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MET27_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KDM1A_HUMAN | KDM1A | physical | 23455924 | |
ANM6_HUMAN | PRMT6 | physical | 23455924 | |
P55G_HUMAN | PIK3R3 | physical | 25814554 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...