| UniProt ID | MET27_HUMAN | |
|---|---|---|
| UniProt AC | Q8N6F8 | |
| Protein Name | Methyltransferase-like protein 27 {ECO:0000312|HGNC:HGNC:19068} | |
| Gene Name | METTL27 {ECO:0000312|HGNC:HGNC:19068} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 245 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPELHVTKPGGLVCLTTRTNSSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWRWYPASLPRMASSPALSTCTESGRRPRLRK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 28 | Ubiquitination | GIPDLAQKLHFYDRW CCCHHHHHHCCHHCC | 21906983 | ||
| 214 | Phosphorylation | AGSWLPPSWRWYPAS CCCCCCCCCCCCCCC | 26091039 | ||
| 221 | Phosphorylation | SWRWYPASLPRMASS CCCCCCCCCCCCCCC | 24719451 | ||
| 227 | Phosphorylation | ASLPRMASSPALSTC CCCCCCCCCCCHHHC | 22210691 | ||
| 228 | Phosphorylation | SLPRMASSPALSTCT CCCCCCCCCCHHHCC | 22210691 | ||
| 232 | Phosphorylation | MASSPALSTCTESGR CCCCCCHHHCCCCCC | 22210691 | ||
| 233 | Phosphorylation | ASSPALSTCTESGRR CCCCCHHHCCCCCCC | 22210691 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MET27_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MET27_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MET27_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KDM1A_HUMAN | KDM1A | physical | 23455924 | |
| ANM6_HUMAN | PRMT6 | physical | 23455924 | |
| P55G_HUMAN | PIK3R3 | physical | 25814554 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...