UniProt ID | MESD_CHICK | |
---|---|---|
UniProt AC | Q5ZKK4 | |
Protein Name | LRP chaperone MESD {ECO:0000305} | |
Gene Name | mesd | |
Organism | Gallus gallus (Chicken). | |
Sequence Length | 220 | |
Subcellular Localization | Endoplasmic reticulum . | |
Protein Description | Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway, since some LDLRs are coreceptors for the canonical Wnt pathway (By similarity).. | |
Protein Sequence | MAAAARWAALGLALWLCAAAHAEEPEGKRRAGPAKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPPAPIDFSKIDPGKPESILKLTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSNRAIFMLRDGGYAWEIKDFLISQERCADVTLEGQVYPGKGADGSEKGRNKTKPEKAKKKKDAEKSKSSHEDNRAQTKQREDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
187 | N-linked_Glycosylation | DGSEKGRNKTKPEKA CCCCCCCCCCCHHHH | 66.08 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MESD_CHICK !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MESD_CHICK !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MESD_CHICK !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MESD_CHICK !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...