dbPTM

MESD_CHICK - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MESD_CHICK
UniProt AC	Q5ZKK4
Protein Name	LRP chaperone MESD {ECO:0000305}
Gene Name	mesd
Organism	Gallus gallus (Chicken).
Sequence Length	220
Subcellular Localization	Endoplasmic reticulum .
Protein Description	Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway, since some LDLRs are coreceptors for the canonical Wnt pathway (By similarity)..
Protein Sequence	MAAAARWAALGLALWLCAAAHAEEPEGKRRAGPAKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPPAPIDFSKIDPGKPESILKLTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSNRAIFMLRDGGYAWEIKDFLISQERCADVTLEGQVYPGKGADGSEKGRNKTKPEKAKKKKDAEKSKSSHEDNRAQTKQREDL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
187	N-linked_Glycosylation	DGSEKGRNKTKPEKA CCCCCCCCCCCHHHH	66.08	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MESD_CHICK !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MESD_CHICK !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MESD_CHICK !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MESD_CHICK !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MESD_CHICK

Related Literatures of Post-Translational Modification