UniProt ID | MEP50_XENLA | |
---|---|---|
UniProt AC | Q6NUD0 | |
Protein Name | Methylosome protein 50 | |
Gene Name | wdr77 | |
Organism | Xenopus laevis (African clawed frog). | |
Sequence Length | 333 | |
Subcellular Localization | Cytoplasm . Nucleus . Enriched on chromatin. | |
Protein Description | Non-catalytic component of the 20S prmt5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins and histones. Required for normal prmt5 methyltransferase activity.. | |
Protein Sequence | MSKGSAWGRPVTAPACMEVQIGAVRYRRDGALLLAASSLSSRTWGGSIWVFKDPEGAPNESLCTAGVQTEAGVTDVAWVSEKGILVASDSGAVELWEILEKESLLVNKFAKYEHDDIVKTLSVFSDGTQAVSGGKDFSVKVWDLSQKAVLKSYNAHSSEVNCVAACPGKDTIFLSCGEDGRILLWDTRKPKPATRIDFCASDTIPTSVTWHPEKDDTFACGDETGNVSLVNIKNPDSAQTSAVHSQNITGLAYSYHSSPFLASISEDCTVAVLDADFSEVFRDLSHRDFVTGVAWSPLDHSKFTTVGWDHKVLHHHLPSEGRTENLIATKAED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of MEP50_XENLA !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MEP50_XENLA !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MEP50_XENLA !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MEP50_XENLA !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...