dbPTM

MEP50_XENLA - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MEP50_XENLA
UniProt AC	Q6NUD0
Protein Name	Methylosome protein 50
Gene Name	wdr77
Organism	Xenopus laevis (African clawed frog).
Sequence Length	333
Subcellular Localization	Cytoplasm . Nucleus . Enriched on chromatin.
Protein Description	Non-catalytic component of the 20S prmt5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins and histones. Required for normal prmt5 methyltransferase activity..
Protein Sequence	MSKGSAWGRPVTAPACMEVQIGAVRYRRDGALLLAASSLSSRTWGGSIWVFKDPEGAPNESLCTAGVQTEAGVTDVAWVSEKGILVASDSGAVELWEILEKESLLVNKFAKYEHDDIVKTLSVFSDGTQAVSGGKDFSVKVWDLSQKAVLKSYNAHSSEVNCVAACPGKDTIFLSCGEDGRILLWDTRKPKPATRIDFCASDTIPTSVTWHPEKDDTFACGDETGNVSLVNIKNPDSAQTSAVHSQNITGLAYSYHSSPFLASISEDCTVAVLDADFSEVFRDLSHRDFVTGVAWSPLDHSKFTTVGWDHKVLHHHLPSEGRTENLIATKAED

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MEP50_XENLA !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MEP50_XENLA !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MEP50_XENLA !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MEP50_XENLA !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MEP50_XENLA

Related Literatures of Post-Translational Modification