| UniProt ID | MEP33_SCHPO | |
|---|---|---|
| UniProt AC | Q9USV4 | |
| Protein Name | mRNA export protein 33 | |
| Gene Name | mep33 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 292 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. Active directional transport is assured by both, a Phe-Gly (FG) repeat affinity gradient for these transport factors across the NPC and a transport cofactor concentration gradient across the nuclear envelope. Involved in the export of mRNA from the nucleus to the cytoplasm. May play a role in mitotic spindle formation and/or function.. | |
| Protein Sequence | MPPKKAAKGKGDPGKAAKKDPTKKAADATFGLKNKNRSTKVQAKIRQIEQNAAASGSKDAKRQEALRKRREEEKRAAEAAKAEVAALFNAIPKKQTPQNFLTRKEEVKESQKIDLYSDVRDQQTDLPLEKRPWINTDIVCKFFLEACETGKYGWLWQCPNGNMTCIYKHALPYGYVLSRDKKKDDTKEEISLEAFIEIERHRLGPNLTPVTEENFKKWSDGRRDRILKQAEERRSNRAVGRSNLSGREYFESNKDKTHEVVGDEEDWDFSALRRETEALAKAQDATAPIVSV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 291 | Phosphorylation | DATAPIVSV------ HCCCCCCCC------ | 23.87 | 25720772 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MEP33_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MEP33_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MEP33_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MEP33_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...