dbPTM

MEP33_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MEP33_SCHPO
UniProt AC	Q9USV4
Protein Name	mRNA export protein 33
Gene Name	mep33
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	292
Subcellular Localization	Cytoplasm .
Protein Description	Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. Active directional transport is assured by both, a Phe-Gly (FG) repeat affinity gradient for these transport factors across the NPC and a transport cofactor concentration gradient across the nuclear envelope. Involved in the export of mRNA from the nucleus to the cytoplasm. May play a role in mitotic spindle formation and/or function..
Protein Sequence	MPPKKAAKGKGDPGKAAKKDPTKKAADATFGLKNKNRSTKVQAKIRQIEQNAAASGSKDAKRQEALRKRREEEKRAAEAAKAEVAALFNAIPKKQTPQNFLTRKEEVKESQKIDLYSDVRDQQTDLPLEKRPWINTDIVCKFFLEACETGKYGWLWQCPNGNMTCIYKHALPYGYVLSRDKKKDDTKEEISLEAFIEIERHRLGPNLTPVTEENFKKWSDGRRDRILKQAEERRSNRAVGRSNLSGREYFESNKDKTHEVVGDEEDWDFSALRRETEALAKAQDATAPIVSV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
291	Phosphorylation	DATAPIVSV------ HCCCCCCCC------	23.87	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MEP33_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MEP33_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MEP33_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MEP33_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MEP33_SCHPO

Related Literatures of Post-Translational Modification