MED9_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MED9_DROME
• UniProt AC: A1ZB42
• Protein Name: Mediator of RNA polymerase II transcription subunit 9
• Gene Name: MED9
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 144
• Subcellular Localization: Nucleus .
• Protein Description: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity)..
• Protein Sequence: MMDLSPNNQIEDRKPILTADGLVQTSNSPFEPTISQETQTSNGIGGQCHLTVDQLDIEILPIIYDIVRCVEKDPLENAVKLRESQDCNHKIFELQKRFESAREQIRQLPGIDFNKEEQQQRLELLRNQLKLKQQLIRKYKDTEF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MMDLSPNNQIED ---CCCCCCCCCCCC	22.71	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MED9_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MED9_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MED9_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MED4_DROME	MED4	physical	14605208
PSMD6_DROME	Rpn7	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.