UniProt ID | MED9_DROME | |
---|---|---|
UniProt AC | A1ZB42 | |
Protein Name | Mediator of RNA polymerase II transcription subunit 9 | |
Gene Name | MED9 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 144 | |
Subcellular Localization | Nucleus . | |
Protein Description | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).. | |
Protein Sequence | MMDLSPNNQIEDRKPILTADGLVQTSNSPFEPTISQETQTSNGIGGQCHLTVDQLDIEILPIIYDIVRCVEKDPLENAVKLRESQDCNHKIFELQKRFESAREQIRQLPGIDFNKEEQQQRLELLRNQLKLKQQLIRKYKDTEF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MMDLSPNNQIED ---CCCCCCCCCCCC | 22.71 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MED9_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MED9_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MED9_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MED4_DROME | MED4 | physical | 14605208 | |
PSMD6_DROME | Rpn7 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...