dbPTM

MED32_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MED32_ARATH
UniProt AC	Q84VW5
Protein Name	Mediator of RNA polymerase II transcription subunit 32
Gene Name	MED32
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	151
Subcellular Localization	Nucleus .
Protein Description	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors..
Protein Sequence	MDNIVDSLNKAYEKFVLASAGVLESKESAGGQKALLTDTALENFKEKWELFRVACDQAEEFVESVKQRIGSECLVDEATGLTTTAAGGQAPAAVTGAATSLPPISAVRLEQMSRAVRWLVLELQRGSGVAPGSVHSSSTGFDSRFSEDSTQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Phosphorylation	ASAGVLESKESAGGQ HHHCCHHCHHCCCCC	37.25	19880383
133	Phosphorylation	GSGVAPGSVHSSSTG CCCCCCCCCCCCCCC	18.65	25561503
138	Phosphorylation	PGSVHSSSTGFDSRF CCCCCCCCCCCCCCC	35.25	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MED32_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MED32_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MED32_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MED32_ARATH

Related Literatures of Post-Translational Modification