UniProt ID | MED29_MOUSE | |
---|---|---|
UniProt AC | Q9DB91 | |
Protein Name | Mediator of RNA polymerase II transcription subunit 29 | |
Gene Name | Med29 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 199 | |
Subcellular Localization | Nucleus. | |
Protein Description | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).. | |
Protein Sequence | MAAPQPQAAAVSSASGVSGPGSAGGPGPQQQPQPTQLVGSAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDAPLQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQITCAKDIHTALLDCANKVTGKTTAPSTGPGGSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAPQPQAA ------CCCCCCCHH | 28.05 | - | |
12 | Phosphorylation | QPQAAAVSSASGVSG CCCHHHHHHCCCCCC | 18.56 | 25338131 | |
22 | Phosphorylation | SGVSGPGSAGGPGPQ CCCCCCCCCCCCCCC | 27.20 | 25338131 | |
175 | Phosphorylation | TCAKDIHTALLDCAN HCCHHHHHHHHHHHH | 21.23 | - | |
183 | Ubiquitination | ALLDCANKVTGKTTA HHHHHHHHCCCCCCC | 23.73 | 22790023 | |
198 | Phosphorylation | PSTGPGGSL------ CCCCCCCCC------ | 36.50 | 30635358 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MED29_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MED29_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MED29_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MED29_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...