| UniProt ID | MDHC_CHICK | |
|---|---|---|
| UniProt AC | Q5ZME2 | |
| Protein Name | Malate dehydrogenase, cytoplasmic | |
| Gene Name | MDH1 | |
| Organism | Gallus gallus (Chicken). | |
| Sequence Length | 334 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | ||
| Protein Sequence | MGEPIRVLVTGAAGQIAYSLLYSIAKGDVFGKEQPLVLVLLDITPMMTVLEGVVMELQDCALPLLREVIPTDKEEVAFKDLDIAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKTVKVVVVGNPANTNCLIASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTSNDVKNVIIWGNHSSTQYPDVNHAKVNVKGKEVGVYEAIKDDSWLKGDFILTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPAGEFVSMGVISDGNSYGVPEDLLYSFPVVIKDKTWKFVEGLPINDFSREKMDLTAKELTEEKETAVEFLSSA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of MDHC_CHICK !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MDHC_CHICK !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MDHC_CHICK !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MDHC_CHICK !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MDHC_CHICK !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
