dbPTM

MD2L2_XENLA - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MD2L2_XENLA
UniProt AC	Q8QFR4
Protein Name	Mitotic spindle assembly checkpoint protein MAD2B
Gene Name	mad2l2
Organism	Xenopus laevis (African clawed frog).
Sequence Length	211
Subcellular Localization	Nucleus . Cytoplasm, cytoskeleton, spindle. Cytoplasm.
Protein Description	Adapter protein able to interact with different proteins and involved in different biological processes. Mediates the interaction between the error-prone DNA polymerase zeta catalytic subunit rev3l and the inserter polymerase rev1, thereby mediating the second polymerase switching in translesion DNA synthesis. Translesion DNA synthesis releases the replication blockade of replicative polymerases, stalled in presence of DNA lesions. May also play a role in signal transduction in response to DNA damage. May regulate the activation of the anaphase promoting complex APC thereby regulating progression through the cell cycle. Through transcriptional regulation may play a role in epithelial-mesenchymal transdifferentiation.; Inhibits the fzr1-APC complex activity during mitosis. Plays a role in progression of mitosis..
Protein Sequence	MTTLTRQDLNFGQVVADILCEFLEVAVHLILYVREVYPTGIFQKRKKYNVPVQMSCHPELNRYIQDTLHCVKPLIEKNDVEKVVVVILDKEHHPVERFVFEIAQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDNNPPGCTFTLLVHTREAATRNMEKIQVIKDFPWILADEQDVHMQEPRLIPLKTMTSDILKMQLYVEERAQKST

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MD2L2_XENLA !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MD2L2_XENLA !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MD2L2_XENLA !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MD2L2_XENLA !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MD2L2_XENLA !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MD2L2_XENLA

Related Literatures of Post-Translational Modification