UniProt ID | MCRI1_HUMAN | |
---|---|---|
UniProt AC | C9JLW8 | |
Protein Name | Mapk-regulated corepressor-interacting protein 1 {ECO:0000303|PubMed:25728771} | |
Gene Name | MCRIP1 {ECO:0000303|PubMed:25728771, ECO:0000312|HGNC:HGNC:28007} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 97 | |
Subcellular Localization | Nucleus . Cytoplasm, Stress granule . | |
Protein Description | The phosphorylation status of MCRIP1 functions as a molecular switch to regulate epithelial-mesenchymal transition. Unphosphorylated MCRIP1 binds to and inhibits the transcriptional corepressor CTBP(s). When phosphorylated by MAPK/ERK, MCRIP1 releases CTBP(s) resulting in transcriptional silencing of the E-cadherin gene and induction of epithelial-mesenchymal transition. [PubMed: 25728771] | |
Protein Sequence | MTSSPVSRVVYNGKRTSSPRSPPSSSEIFTPAHEENVRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKVPNPSLKTFKPIDLSDLKRRSTQDAKKS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTSSPVSRV ------CCCCCCCEE | 29255136 | ||
3 | Phosphorylation | -----MTSSPVSRVV -----CCCCCCCEEE | 25849741 | ||
4 | Phosphorylation | ----MTSSPVSRVVY ----CCCCCCCEEEE | 25849741 | ||
7 | Phosphorylation | -MTSSPVSRVVYNGK -CCCCCCCEEEECCC | 26074081 | ||
11 | Phosphorylation | SPVSRVVYNGKRTSS CCCCEEEECCCCCCC | 26074081 | ||
14 | Acetylation | SRVVYNGKRTSSPRS CEEEECCCCCCCCCC | 25953088 | ||
16 | Phosphorylation | VVYNGKRTSSPRSPP EEECCCCCCCCCCCC | 25159151 | ||
17 | Phosphorylation | VYNGKRTSSPRSPPS EECCCCCCCCCCCCC | 23927012 | ||
18 | Phosphorylation | YNGKRTSSPRSPPSS ECCCCCCCCCCCCCC | 23927012 | ||
21 | Phosphorylation | KRTSSPRSPPSSSEI CCCCCCCCCCCCCCC | 29255136 | ||
24 | Phosphorylation | SSPRSPPSSSEIFTP CCCCCCCCCCCCCCC | 22167270 | ||
25 | Phosphorylation | SPRSPPSSSEIFTPA CCCCCCCCCCCCCCC | 30278072 | ||
26 | Phosphorylation | PRSPPSSSEIFTPAH CCCCCCCCCCCCCCC | 23927012 | ||
30 | Phosphorylation | PSSSEIFTPAHEENV CCCCCCCCCCCHHHH | 23927012 | ||
41 | Phosphorylation | EENVRFIYEAWQGVE HHHHHHHHHHHCCCC | 21945579 | ||
66 | Phosphorylation | ERGLVEEYVEKVPNP CCCHHHHHHHCCCCC | 29978859 | ||
74 | Phosphorylation | VEKVPNPSLKTFKPI HHCCCCCCCCCCCCC | 29978859 | ||
76 | Ubiquitination | KVPNPSLKTFKPIDL CCCCCCCCCCCCCCH | 21890473 | ||
79 | Acetylation | NPSLKTFKPIDLSDL CCCCCCCCCCCHHHH | 19608861 | ||
84 | Phosphorylation | TFKPIDLSDLKRRST CCCCCCHHHHHHHCH | 22199227 | ||
87 | Acetylation | PIDLSDLKRRSTQDA CCCHHHHHHHCHHHH | 26051181 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MCRI1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MCRI1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MCRI1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...