dbPTM

MCP6_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MCP6_SCHPO
UniProt AC	Q10336
Protein Name	Meiotic coiled-coil protein 6
Gene Name	mcp6
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	327
Subcellular Localization	Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body. Localizes to the spindle pole body until the onset of meiosis I.
Protein Description	Has a role in meiotic nuclear oscillation and recombination. Required to remodel astral microtubules into the 'horsetail' astral array maintaining the 'horsetail' nuclear movement. Promotes homologous paring of chromosomes during this movement..
Protein Sequence	MEYQEEASLASAEDSTFIASSPVQSVSEMKSIKQKSFQYFDDYEKNVSDKTIQFQKLQMTAKEIIDAFERDSTQRTLQIESLESKIGEQERDLNNEKLASETLREKTQLLEKENGALKVENGYLYEKSRKLEEEMAHLKKKCNVYKSKFEESSLRCKSLYSSNTKLKDSMETMKRRMETETKEMNKIKPKNDSESDRFKRNSQSLSQQSPLLDVHSPDNSNHRTMLNINNSSPIKPKKIFKPNEVKNRISRLQKTFADLENQHHSFQQICQTLRKRLENDSSTTKQRLSKLEEIIRNRAPPSYSFSLNCSHTYQPVSCVEPVNHDLS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MCP6_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MCP6_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MCP6_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MCP6_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MCP6_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MCP6_SCHPO

Related Literatures of Post-Translational Modification