UniProt ID | MBL2_MOUSE | |
---|---|---|
UniProt AC | P41317 | |
Protein Name | Mannose-binding protein C | |
Gene Name | Mbl2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 244 | |
Subcellular Localization | Secreted. | |
Protein Description | Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages (By similarity).. | |
Protein Sequence | MSIFTSFLLLCVVTVVYAETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
43 | Hydroxylation | SPGLNGFPGKDGRDG CCCCCCCCCCCCCCC | 50.77 | - | |
58 | Hydroxylation | AKGEKGEPGQGLRGL CCCCCCCCCCCCCCC | 49.42 | - | |
69 | Hydroxylation | LRGLQGPPGKVGPTG CCCCCCCCCCCCCCC | 63.16 | - | |
78 | Hydroxylation | KVGPTGPPGNPGLKG CCCCCCCCCCCCCCC | 57.44 | - | |
81 | Hydroxylation | PTGPPGNPGLKGAVG CCCCCCCCCCCCCCC | 56.24 | - | |
152 | Phosphorylation | DRVKALCSEFQGSVA HHHHHHHHHHCCCCC | 42.15 | 25168779 | |
157 | Phosphorylation | LCSEFQGSVATPRNA HHHHHCCCCCCCCCH | 9.59 | 25168779 | |
160 | Phosphorylation | EFQGSVATPRNAEEN HHCCCCCCCCCHHHC | 22.18 | 25168779 | |
183 | Phosphorylation | DIAYLGITDVRVEGS HHHHCCCCEEEEEEC | 27.00 | 24719451 | |
190 | Phosphorylation | TDVRVEGSFEDLTGN CEEEEEECEECCCCC | 16.38 | 30352176 | |
210 | N-linked_Glycosylation | NWNDGEPNNTGDGED CCCCCCCCCCCCCCC | 55.16 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MBL2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MBL2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MBL2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MBL2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...