dbPTM

MBF1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MBF1_SCHPO
UniProt AC	O94700
Protein Name	Multiprotein-bridging factor 1
Gene Name	mbf1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	148
Subcellular Localization
Protein Description	Transcriptional coactivator that stimulates transcriptional activity by bridging regulatory proteins and TBP, thereby recruiting TBP to promoters occupied by DNA-binding regulators..
Protein Sequence	MSDWDTVTKIGSRAGPGARTHVAKTQSQINSARRAGAIVGTEKKYATGNKSQDPAGQHLTKIDRENEVKPPSTTGRSVAQAIQKGRQAKGWAQKDLSQRINEKPQVVNDYESGRAIPNQQVLSKMERALGIKLRGQNIGAPLGGPKKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	DTVTKIGSRAGPGAR HHHHHCCCCCCCCHH	23.56	21712547
27	Phosphorylation	THVAKTQSQINSARR HHHHHHHHHHHHHHH	37.95	27738172
31	Phosphorylation	KTQSQINSARRAGAI HHHHHHHHHHHHCCE	25.45	21712547
47	Phosphorylation	GTEKKYATGNKSQDP ECCCCCCCCCCCCCC	37.89	25720772
51	Phosphorylation	KYATGNKSQDPAGQH CCCCCCCCCCCCHHC	43.76	24763107
72	Phosphorylation	ENEVKPPSTTGRSVA CCCCCCCCCCCHHHH	47.32	25720772
74	Phosphorylation	EVKPPSTTGRSVAQA CCCCCCCCCHHHHHH	34.63	25720772
77	Phosphorylation	PPSTTGRSVAQAIQK CCCCCCHHHHHHHHH	24.13	27738172
112	Phosphorylation	QVVNDYESGRAIPNQ CCCCCHHHCCCCCCH	27.61	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MBF1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MBF1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MBF1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MBF1_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MBF1_SCHPO

Related Literatures of Post-Translational Modification