MBD5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MBD5_ARATH
• UniProt AC: Q9SNC0
• Protein Name: Methyl-CpG-binding domain-containing protein 5
• Gene Name: MBD5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 182
• Subcellular Localization: Nucleus . Chromosome . Associated with heterochromatin, and particularly at perinucleolar chromocenters.
• Protein Description: Transcriptional regulator that binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides. In addition, binds specifically methylated m(5)CpNpN but not m(5)CpNpG (N is A, T or C). Plays probably a role in gene silencing..
• Protein Sequence: MSNGTDQAQPPPENPATPVDSKSRKRATPGDDNWLPPDWRTEIRVRTSGTKAGTVDKFYYEPITGRKFRSKNEVLYYLEHGTPKKKSVKTAENGDSHSEHSEGRGSARRQTKSNKKVTEPPPKPLNFDFLNVPEKVTWTGINGSEEAWLPFIGDYKIQESVSQDWDRVFTLVTSQNAGKTMF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSNGTDQAQ ------CCCCCCCCC	43.92	27531888
5	Phosphorylation	---MSNGTDQAQPPP ---CCCCCCCCCCCC	29.23	27531888
21	Phosphorylation	NPATPVDSKSRKRAT CCCCCCCCCCCCCCC	32.53	27531888
82	Phosphorylation	LYYLEHGTPKKKSVK EEEECCCCCCCCCCE	33.57	23776212
98	Phosphorylation	AENGDSHSEHSEGRG CCCCCCCCCCCCCCC	40.74	25561503
101	Phosphorylation	GDSHSEHSEGRGSAR CCCCCCCCCCCCCCC	37.38	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MBD5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MBD5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MBD5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DDM1_ARATH	CHR1	physical	15805479
MBD6_ARATH	MBD6	physical	15805479
RAN3_ARATH	RAN3	physical	17008347

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.