MBD1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MBD1_ARATH
• UniProt AC: Q5XEN5
• Protein Name: Methyl-CpG-binding domain-containing protein 1
• Gene Name: MBD1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 204
• Subcellular Localization: Nucleus .
• Protein Description: Probable transcriptional regulator..
• Protein Sequence: MLPFPAMNLKKSRSENSSVASSGSKIEEQTEKSAEPTTIKVQKKAGTPGRSIDVFAVQCEKCMKWRKIDTQDEYEDIRSRVQEDPFFCKTKEGVSCEDVGDLNYDSSRTWVIDKPGLPRTPRGFKRSLILRKDYSKMDAYYITPTGKKLKSRNEIAAFIDANQDYKYALLGDFNFTVPKVMEETVPSGILSDRTPKPSRKVTID

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17	Phosphorylation	KKSRSENSSVASSGS CCCCCCCCCCCCCCC	23.34	19880383
18	Phosphorylation	KSRSENSSVASSGSK CCCCCCCCCCCCCCH	33.03	19880383
194	Phosphorylation	SGILSDRTPKPSRKV CCCCCCCCCCCCCCC	40.43	25561503
198	Phosphorylation	SDRTPKPSRKVTID- CCCCCCCCCCCCCC-	51.35	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MBD1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MBD1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MBD1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of MBD1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.