UniProt ID | MBD1_ARATH | |
---|---|---|
UniProt AC | Q5XEN5 | |
Protein Name | Methyl-CpG-binding domain-containing protein 1 | |
Gene Name | MBD1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 204 | |
Subcellular Localization | Nucleus . | |
Protein Description | Probable transcriptional regulator.. | |
Protein Sequence | MLPFPAMNLKKSRSENSSVASSGSKIEEQTEKSAEPTTIKVQKKAGTPGRSIDVFAVQCEKCMKWRKIDTQDEYEDIRSRVQEDPFFCKTKEGVSCEDVGDLNYDSSRTWVIDKPGLPRTPRGFKRSLILRKDYSKMDAYYITPTGKKLKSRNEIAAFIDANQDYKYALLGDFNFTVPKVMEETVPSGILSDRTPKPSRKVTID | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Phosphorylation | KKSRSENSSVASSGS CCCCCCCCCCCCCCC | 23.34 | 19880383 | |
18 | Phosphorylation | KSRSENSSVASSGSK CCCCCCCCCCCCCCH | 33.03 | 19880383 | |
194 | Phosphorylation | SGILSDRTPKPSRKV CCCCCCCCCCCCCCC | 40.43 | 25561503 | |
198 | Phosphorylation | SDRTPKPSRKVTID- CCCCCCCCCCCCCC- | 51.35 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MBD1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MBD1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MBD1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MBD1_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...