dbPTM

MATN1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MATN1_MOUSE
UniProt AC	P51942
Protein Name	Cartilage matrix protein
Gene Name	Matn1
Organism	Mus musculus (Mouse).
Sequence Length	500
Subcellular Localization	Secreted, extracellular space, extracellular matrix.
Protein Description	Cartilage matrix protein is a major component of the extracellular matrix of non-articular cartilage. It binds to collagen..
Protein Sequence	MKVTSGPAFALCSLLLLLLLLLQVPDSLSLVPQPRGHLCRTRPTDLVFVVDSSRSVRPVEFEKVKVFLSQVIESLDVGPNATRVGLVNYASTVKPEFPLRAHGSKASLLQAVRRIQPLSTGTMTGLALQFAITKALSDAEGGRARSPDISKVVIVVTDGRPQDSVRDVSERARASGIELFAIGVGRVDKATLRQIASEPQDEHVDYVESYNVIEKLAKKFQEAFCVVSDLCATGDHDCEQLCVSSPGSYTCACHEGFTLNSDGKTCNVCRGGGSGSATDLVFLIDGSKSVRPENFELVKKFINQIVDTLDVSDRLAQVGLVQYSSSIRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAARKAKDLGFKMFAVGVGNAVEEELREIASEPVADHYFYTADFKTINQIGKKLQKQICVEEDPCACESILKFEAKVEGLLQALTRKLEAVSGRLAVLENRII

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
80	N-linked_Glycosylation	ESLDVGPNATRVGLV HHCCCCCCCEEEEEE	48.27	-
348	N-linked_Glycosylation	DIKAAVRNMSYMEKG HHHHHHHCCCHHHHC	19.70	-
466	Phosphorylation	EDPCACESILKFEAK CCCCCCHHHHHHHHH	32.86	25338131

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MATN1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MATN1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MATN1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MATN1_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MATN1_MOUSE

Related Literatures of Post-Translational Modification