| UniProt ID | MALD1_HUMAN | |
|---|---|---|
| UniProt AC | Q9BSK0 | |
| Protein Name | MARVEL domain-containing protein 1 | |
| Gene Name | MARVELD1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 173 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. Cytoplasm, cytoskeleton. Nucleus . Observed in the nucleus and at the perinuclear region during interphase, but localizes at the mitotic spindle and midbody at metaphase. A significant fraction of MARVELD1 |
|
| Protein Description | Microtubule-associated protein that exhibits cell cycle-dependent localization and can inhibit cell proliferation and migration.. | |
| Protein Sequence | MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHFALFVSVLFWLLTLGLYFLTLLGKHELVPVLGSRWLMVNVAHDVLAAALYGAATGIMSDQMQRHSYCNLKDYPLPCAYHAFLAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MLPPPPRQ -------CCCCCCCC | 13.15 | 22223895 | |
| 29 | Phosphorylation | LQRPFLRSPLGVLRL HCCHHHCCHHHHHHH | 26.99 | 23312004 | |
| 117 | Phosphorylation | GAATGIMSDQMQRHS HHHHCCCCHHHHHHC | 23.83 | - | |
| 125 | Phosphorylation | DQMQRHSYCNLKDYP HHHHHHCCCCCCCCC | 4.53 | - | |
| 154 | Phosphorylation | GGVCHGLYLLSALYG HHHHHHHHHHHHHHC | 15.36 | - | |
| 169 | Ubiquitination | CGRRCQGKQEVA--- CCHHCCCCCCCC--- | 19.87 | 33845483 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MALD1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MALD1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MALD1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MALD1_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
