dbPTM

MAE1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MAE1_SCHPO
UniProt AC	P50537
Protein Name	Malic acid transport protein
Gene Name	mae1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	438
Subcellular Localization	Membrane Multi-pass membrane protein.
Protein Description	Permease for malate and other C4 dicarboxylic acids..
Protein Sequence	MGELKEILKQRYHELLDWNVKAPHVPLSQRLKHFTWSWFACTMATGGVGLIIGSFPFRFYGLNTIGKIVYILQIFLFSLFGSCMLFRFIKYPSTIKDSWNHHLEKLFIATCLLSISTFIDMLAIYAYPDTGEWMVWVIRILYYIYVAVSFIYCVMAFFTIFNNHVYTIETASPAWILPIFPPMICGVIAGAVNSTQPAHQLKNMVIFGILFQGLGFWVYLLLFAVNVLRFFTVGLAKPQDRPGMFMFVGPPAFSGLALINIARGAMGSRPYIFVGANSSEYLGFVSTFMAIFIWGLAAWCYCLAMVSFLAGFFTRAPLKFACGWFAFIFPNVGFVNCTIEIGKMIDSKAFQMFGHIIGVILCIQWILLMYLMVRAFLVNDLCYPGKDEDAHPPPKPNTGVLNPTFPPEKAPASLEKVDTHVTSTGGESDPPSSEHESV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
413	Phosphorylation	PPEKAPASLEKVDTH CCCCCCCCHHCCCCC	35.68	28889911
419	Phosphorylation	ASLEKVDTHVTSTGG CCHHCCCCCCCCCCC	22.64	24763107
422	Phosphorylation	EKVDTHVTSTGGESD HCCCCCCCCCCCCCC	16.99	24763107
423	Phosphorylation	KVDTHVTSTGGESDP CCCCCCCCCCCCCCC	24.78	28889911
424	Phosphorylation	VDTHVTSTGGESDPP CCCCCCCCCCCCCCC	39.58	25720772
428	Phosphorylation	VTSTGGESDPPSSEH CCCCCCCCCCCCCCC	59.71	28889911
432	Phosphorylation	GGESDPPSSEHESV- CCCCCCCCCCCCCC-	54.46	28889911
433	Phosphorylation	GESDPPSSEHESV-- CCCCCCCCCCCCC--	49.06	28889911
437	Phosphorylation	PPSSEHESV------ CCCCCCCCC------	34.73	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MAE1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MAE1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MAE1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MAE1_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MAE1_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-413; SER-423; SER-428;SER-432; SER-433 AND SER-437, AND MASS SPECTROMETRY.	18257517 [Abstract]