UniProt ID | M17L2_HUMAN | |
---|---|---|
UniProt AC | Q567V2 | |
Protein Name | Mpv17-like protein 2 | |
Gene Name | MPV17L2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 206 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . Mitochondrion inner membrane . |
|
Protein Description | Required for the assembly and stability of the mitochondrial ribosome. [PubMed: 24948607 Is a positive regulator of mitochondrial protein synthesis] | |
Protein Sequence | MARGGWRRLRRLLSAGQLLFQGRALLVTNTLGCGALMAAGDGVRQSWEIRARPGQVFDPRRSASMFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGLGCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | RRLRRLLSAGQLLFQ HHHHHHHHHHCHHHC | 34.64 | 28122231 | |
46 | Phosphorylation | AGDGVRQSWEIRARP CCCCCHHEEEEECCC | 18.99 | 24719451 | |
187 | Phosphorylation | TYLSYLKYRSPVPLT HHHHHHCCCCCCCCC | 17.46 | 17924679 | |
189 | Phosphorylation | LSYLKYRSPVPLTPP HHHHCCCCCCCCCCC | 27.45 | 28258704 | |
194 | Phosphorylation | YRSPVPLTPPGCVAL CCCCCCCCCCCCEEE | 22.74 | - | |
203 | Phosphorylation | PGCVALDTRAD---- CCCEEEECCCC---- | 28.71 | 17924679 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of M17L2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of M17L2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of M17L2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of M17L2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Improved titanium dioxide enrichment of phosphopeptides from HeLacells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra."; Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D.; J. Proteome Res. 6:4150-4162(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-187; SER-189 ANDTHR-203, AND MASS SPECTROMETRY. |