LYZ1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LYZ1_MOUSE
• UniProt AC: P17897
• Protein Name: Lysozyme C-1
• Gene Name: Lyz1
• Organism: Mus musculus (Mouse).
• Sequence Length: 148
• Subcellular Localization: Secreted.
• Protein Description: Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Lyz1 is active against a range of Gram-positive and Gram-negative bacteria. Less effective than Lyz2 in killing Gram-negative bacteria. Lyz1 and Lyz2 are equally effective in killing Gram-positive bacteria..
• Protein Sequence: MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRATNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRDPQGIRAWVAWRTQCQNRDLSQYIRNCGV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
83	Glutathionylation	QINSRYWCNDGKTPR EECCEEECCCCCCCC	2.17	24333276

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LYZ1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LYZ1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LYZ1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of LYZ1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.