LYSM1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LYSM1_HUMAN
• UniProt AC: Q96S90
• Protein Name: LysM and putative peptidoglycan-binding domain-containing protein 1
• Gene Name: LYSMD1
• Organism: Homo sapiens (Human).
• Sequence Length: 227
• Protein Sequence: MASPSRQPPPGGSGLLQGSRARSYGSLVQSACSPVRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEKVHPSNSEVWPHSTERKKQETGAGRANGEVLPTPGQETPTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGENGVPGEDAGLHLSSPWMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MASPSRQPPP -----CCCCCCCCCC	23.31	25159151
5	Phosphorylation	---MASPSRQPPPGG ---CCCCCCCCCCCC	40.84	28464451
13	Phosphorylation	RQPPPGGSGLLQGSR CCCCCCCCCCCCCCH	31.98	22199227
19	Phosphorylation	GSGLLQGSRARSYGS CCCCCCCCHHHHHHH	15.14	22199227
23	Phosphorylation	LQGSRARSYGSLVQS CCCCHHHHHHHHHHH	32.62	25159151
24	Phosphorylation	QGSRARSYGSLVQSA CCCHHHHHHHHHHHH	12.75	21712546
26	Phosphorylation	SRARSYGSLVQSACS CHHHHHHHHHHHHCC	19.68	21712546
30	Phosphorylation	SYGSLVQSACSPVRE HHHHHHHHHCCHHHH	24.62	25159151
33	Phosphorylation	SLVQSACSPVRERRL HHHHHHCCHHHHHHH	26.58	25159151
49	Phosphorylation	HQLEPGDTLAGLALK HCCCCCCCHHHHHHH	25.15	20058876
51	Phosphorylation	LEPGDTLAGLALKYG CCCCCCHHHHHHHHC	17.04	32142685
71	Phosphorylation	IKRANRLYTNDSIFL HHHHHCCCCCCCCCC	10.56	24719451
72	Phosphorylation	KRANRLYTNDSIFLK HHHHCCCCCCCCCCE	36.82	24719451
75	Phosphorylation	NRLYTNDSIFLKKTL HCCCCCCCCCCEEEC	19.81	-
83	Phosphorylation	IFLKKTLYIPILTEP CCCEEECEEEECCCC	15.19	27642862
99	Phosphorylation	DLFNGLDSEEEKDGE HHHCCCCCCHHHCCC	52.53	19664994
112	Phosphorylation	GEEKVHPSNSEVWPH CCCCCCCCCCCCCCC	37.80	23927012
114	Phosphorylation	EKVHPSNSEVWPHST CCCCCCCCCCCCCCC	37.55	23927012
120	Phosphorylation	NSEVWPHSTERKKQE CCCCCCCCCCHHHHC	28.08	25159151
145	Phosphorylation	LPTPGQETPTPIHDL CCCCCCCCCCCHHHC	25.28	25159151
147	Phosphorylation	TPGQETPTPIHDLSA CCCCCCCCCHHHCCH	42.15	21712546
153	Phosphorylation	PTPIHDLSASDFLKK CCCHHHCCHHHHHHH	31.61	21712546
155	Phosphorylation	PIHDLSASDFLKKLD CHHHCCHHHHHHHHH	26.06	21712546
163	Phosphorylation	DFLKKLDSQISLSKK HHHHHHHHHHCCCHH	39.59	28555341
166	Phosphorylation	KKLDSQISLSKKAAA HHHHHHHCCCHHHHH	20.96	25159151
168	Phosphorylation	LDSQISLSKKAAAQK HHHHHCCCHHHHHHH	25.89	25159151
194	Phosphorylation	DAGLHLSSPWMQQRA CCCCCCCCHHHHHCH	29.01	23898821
209	Phosphorylation	VLGPVPLTRTSRTRT HCCCCCCCCCCCCCC	26.32	28348404
212	Phosphorylation	PVPLTRTSRTRTLRD CCCCCCCCCCCCCHH	28.50	14702039
214	Phosphorylation	PLTRTSRTRTLRDQE CCCCCCCCCCCHHHC	27.98	28348404
216	Phosphorylation	TRTSRTRTLRDQEDE CCCCCCCCCHHHCCH	26.07	30576142

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LYSM1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LYSM1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LYSM1_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of LYSM1_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.