UniProt ID | LYPA1_MOUSE | |
---|---|---|
UniProt AC | P97823 | |
Protein Name | Acyl-protein thioesterase 1 | |
Gene Name | Lypla1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 230 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity toward KCNMA1. Has low lysophospholipase activity (By similarity).. | |
Protein Sequence | MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | S-palmitoylation | ------MCGNNMSAP ------CCCCCCCCC | 8.86 | 23396970 | |
47 | Ubiquitination | AFAGIKSPHIKYICP HHCCCCCCCCEEECC | 28.37 | 27667366 | |
97 | Acetylation | KQAAETVKALIDQEV HHHHHHHHHHHHHHH | 44.91 | 23201123 | |
105 | Acetylation | ALIDQEVKNGIPSNR HHHHHHHHCCCCCCC | 49.02 | 23954790 | |
105 | Ubiquitination | ALIDQEVKNGIPSNR HHHHHHHHCCCCCCC | 49.02 | 22790023 | |
144 | S-palmitoylation | AGVTALSCWLPLRAS CCCHHHHHCCCHHCH | 4.50 | 28526873 | |
144 | S-nitrosylation | AGVTALSCWLPLRAS CCCHHHHHCCCHHCH | 4.50 | 21278135 | |
144 | S-nitrosocysteine | AGVTALSCWLPLRAS CCCHHHHHCCCHHCH | 4.50 | - | |
151 | Phosphorylation | CWLPLRASFSQGPIN HCCCHHCHHCCCCCC | 20.99 | 28066266 | |
153 | Phosphorylation | LPLRASFSQGPINSA CCHHCHHCCCCCCCC | 31.56 | 28066266 | |
165 | Ubiquitination | NSANRDISVLQCHGD CCCCCCEEEEEECCC | 22.51 | 27667366 | |
166 | Ubiquitination | SANRDISVLQCHGDC CCCCCEEEEEECCCC | 4.35 | 27667366 | |
190 | Malonylation | SLTVERLKALINPAN CEEHHHHHHHHCHHC | 47.57 | 26320211 | |
190 | Ubiquitination | SLTVERLKALINPAN CEEHHHHHHHHCHHC | 47.57 | - | |
190 | Acetylation | SLTVERLKALINPAN CEEHHHHHHHHCHHC | 47.57 | 23806337 | |
211 | S-nitrosocysteine | EGMMHSSCQQEMMDV CCCCCHHHHHHHHHH | 5.62 | - | |
211 | S-nitrosylation | EGMMHSSCQQEMMDV CCCCCHHHHHHHHHH | 5.62 | 21278135 | |
224 | Acetylation | DVKHFIDKLLPPID- HHHHHHHHHCCCCC- | 47.29 | 23576753 | |
224 | Ubiquitination | DVKHFIDKLLPPID- HHHHHHHHHCCCCC- | 47.29 | 27667366 | |
224 | Malonylation | DVKHFIDKLLPPID- HHHHHHHHHCCCCC- | 47.29 | 26073543 | |
250 | Ubiquitination | --------------------------- --------------------------- | 27667366 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LYPA1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LYPA1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LYPA1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LYPA1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...