UniProt ID | LY6E_HUMAN | |
---|---|---|
UniProt AC | Q16553 | |
Protein Name | Lymphocyte antigen 6E | |
Gene Name | LY6E | |
Organism | Homo sapiens (Human). | |
Sequence Length | 131 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor. |
|
Protein Description | Involved in T-cell development. Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response.. | |
Protein Sequence | MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
37 | Ubiquitination | KSNLYCLKPTICSDQ CCCEEEECCEEECCC | 36.23 | 21963094 | |
50 | O-linked_Glycosylation | DQDNYCVTVSASAGI CCCCEEEEEEECCCC | 12.75 | OGP | |
52 | O-linked_Glycosylation | DNYCVTVSASAGIGN CCEEEEEEECCCCCC | 13.72 | OGP | |
54 | O-linked_Glycosylation | YCVTVSASAGIGNLV EEEEEEECCCCCCCC | 21.37 | OGP | |
62 | O-linked_Glycosylation | AGIGNLVTFGHSLSK CCCCCCCCCCCCCCC | 27.37 | OGP | |
99 | N-linked_Glycosylation | CCQSFLCNFSAADGG HHHHHHHCCCCCCCC | 35.73 | UniProtKB CARBOHYD | |
101 | GPI-anchor | QSFLCNFSAADGGLR HHHHHCCCCCCCCHH | 14.46 | - | |
121 | Phosphorylation | LGAGLLLSLLPALLR HHHHHHHHHHHHHHH | 28.03 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LY6E_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LY6E_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LY6E_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CD3Z_HUMAN | CD247 | physical | 9575182 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...