UniProt ID | LY66F_HUMAN | |
---|---|---|
UniProt AC | Q5SQ64 | |
Protein Name | Lymphocyte antigen 6 complex locus protein G6f | |
Gene Name | LY6G6F | |
Organism | Homo sapiens (Human). | |
Sequence Length | 297 | |
Subcellular Localization |
Cell membrane Single-pass type I membrane protein . |
|
Protein Description | May play a role in the downstream signal transduction pathways involving GRB2 and GRB7.. | |
Protein Sequence | MAVLFLLLFLCGTPQAADNMQAIYVALGEAVELPCPSPPTLHGDEHLSWFCSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEEDAGRYWCAVLGQHHNYQNWRVYDVLVLKGSQLSARAADGSPCNVLLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPRSRRPRIIRCLMTHNKGVSFSLAASIDASPALCAPSTGWDMPWILMLLLTMGQGVVILALSIVLWRQRVRGAPGRDASIPQFKPEIQVYENIHLARLGPPAHKPR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
88 | N-linked_Glycosylation | SRLRLLGNYSLWLEG HHHHHEEEEEEEEEC | 24.16 | 16263699 | |
270 | Phosphorylation | GAPGRDASIPQFKPE CCCCCCCCCCCCCCC | 38.81 | 27535140 | |
281 | Phosphorylation | FKPEIQVYENIHLAR CCCCEEEECCEECCC | 6.20 | 12852788 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LY66F_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LY66F_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LY66F_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LY66F_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Elucidation of N-glycosylation sites on human platelet proteins: aglycoproteomic approach."; Lewandrowski U., Moebius J., Walter U., Sickmann A.; Mol. Cell. Proteomics 5:226-233(2006). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-88, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"Adaptor signalling proteins Grb2 and Grb7 are recruited by human G6f,a novel member of the immunoglobulin superfamily encoded in the MHC."; De Vet E.C.J.M., Aguado B., Campbell R.D.; Biochem. J. 375:207-213(2003). Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, INTERACTION WITH GRB2 AND GRB7,SUBCELLULAR LOCATION, GLYCOSYLATION, PHOSPHORYLATION AT TYR-281, ANDMUTAGENESIS OF TYR-281. |