dbPTM

LSM8_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	LSM8_SCHPO
UniProt AC	O74483
Protein Name	U6 snRNA-associated Sm-like protein LSm8
Gene Name	lsm8
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	94
Subcellular Localization	Nucleus.
Protein Description	Probable component of the spliceosome..
Protein Sequence	MSLADFMEQRVQVITNDGRVVLGSLKGFDHTTNLILSDSFERIISMDQDMETIPLGVYLLRGENVAMVGLVNEELDSEIEWTKIRGEAIPDVVH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
45	Phosphorylation	DSFERIISMDQDMET CCHHHHHCCCCCCCC	17.59	25720772
52	Phosphorylation	SMDQDMETIPLGVYL CCCCCCCCCCCEEEE	22.66	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of LSM8_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of LSM8_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of LSM8_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CEF1_SCHPO	cdc5	physical	11884590

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of LSM8_SCHPO

Related Literatures of Post-Translational Modification