LSM5_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LSM5_MOUSE
• UniProt AC: P62322
• Protein Name: U6 snRNA-associated Sm-like protein LSm5
• Gene Name: Lsm5
• Organism: Mus musculus (Mouse).
• Sequence Length: 91
• Subcellular Localization: Nucleus.
• Protein Description: Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA, thereby facilitating formation of the spliceosomal U4/U6 duplex in vitro (By similarity)..
• Protein Sequence: MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAANATTNP ------CCCCCCCCH	14.93	-
68	Ubiquitination	PEGRRITKLDQILLN CCCCCCCCHHEEEEC	47.93	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LSM5_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LSM5_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LSM5_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of LSM5_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.