UniProt ID | LSM2_MOUSE | |
---|---|---|
UniProt AC | O35900 | |
Protein Name | U6 snRNA-associated Sm-like protein LSm2 | |
Gene Name | Lsm2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 95 | |
Subcellular Localization | Nucleus . | |
Protein Description | Binds specifically to the 3'-terminal U-tract of U6 snRNA. May be involved in pre-mRNA splicing (By similarity).. | |
Protein Sequence | MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
35 | Phosphorylation | TLHSVDQYLNIKLTD CCCCHHHHHCEEEEE | 9.39 | - | |
44 | Phosphorylation | NIKLTDISVTDPEKY CEEEEEEECCCHHHC | 23.05 | 20469934 | |
46 | Phosphorylation | KLTDISVTDPEKYPH EEEEEECCCHHHCCC | 38.76 | 20469934 | |
65 | Phosphorylation | KNCFIRGSVVRYVQL ECCEECCCEEEEEEC | 13.95 | 26239621 | |
79 | Phosphorylation | LPADEVDTQLLQDAA CCHHHHHHHHHHHHH | 26.71 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LSM2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LSM2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LSM2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LSM2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...