dbPTM

LSAMP_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	LSAMP_MOUSE
UniProt AC	Q8BLK3
Protein Name	Limbic system-associated membrane protein
Gene Name	Lsamp
Organism	Mus musculus (Mouse).
Sequence Length	341
Subcellular Localization	Cell membrane Lipid-anchor, GPI-anchor.
Protein Description	Mediates selective neuronal growth and axon targeting. Contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. Essential for normal growth of the hyppocampal mossy fiber projection (By similarity)..
Protein Sequence	MVGRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHALEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPLGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFSKYAKTEPDSMQVIEFLHIDLKSIRHPLKVNPIQK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
31	Phosphorylation	PTGLPVRSVDFNRGT CCCCCCEEEECCCCC	26.69	25777480
40	N-linked_Glycosylation	DFNRGTDNITVRQGD ECCCCCCCEEEECCC	31.50	-
60	Phosphorylation	CVVEDKNSKVAWLNR EEEECCCCCEEEEEC	33.96	21454597
66	N-linked_Glycosylation	NSKVAWLNRSGIIFA CCCEEEEECCCEEEE	25.93	-
68	Phosphorylation	KVAWLNRSGIIFAGH CEEEEECCCEEEEEC	33.02	29899451
94	Phosphorylation	EKRHALEYSLRIQKV HHHHHHEEEEEEEEE	17.54	22817900
111	S-nitrosylation	YDEGSYTCSVQTQHE ECCCEEEEEEEEECC	2.59	24895380
136	N-linked_Glycosylation	QVPPKISNISSDVTV ECCCCCCCCCCCEEE	41.45	-
148	N-linked_Glycosylation	VTVNEGSNVTLVCMA EEECCCCCEEEEEEE	41.47	-
204	Phosphorylation	CKAANEVSSADVKQV EECCCCCCCCCCCEE	17.40	29899451
205	Phosphorylation	KAANEVSSADVKQVK ECCCCCCCCCCCEEE	33.39	29899451
239	S-nitrosylation	GRQASLKCEASAVPA CCCCCCCEEEEECCC	6.83	24895380
279	N-linked_Glycosylation	QSSLTVTNVTEEHYG CCCEEEEECCEEHHC	34.08	-
287	N-linked_Glycosylation	VTEEHYGNYTCVAAN CCEEHHCCEEEEEEC	23.05	-
300	N-linked_Glycosylation	ANKLGVTNASLVLFS ECCCCCCCEEEEEEE	25.73	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of LSAMP_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of LSAMP_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of LSAMP_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of LSAMP_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of LSAMP_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale identification and evolution indexing of tyrosinephosphorylation sites from murine brain."; Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.; J. Proteome Res. 7:311-318(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-94, AND MASSSPECTROMETRY.	18034455 [Abstract]