LRP5L_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LRP5L_HUMAN
• UniProt AC: A4QPB2
• Protein Name: Low-density lipoprotein receptor-related protein 5-like protein
• Gene Name: LRP5L
• Organism: Homo sapiens (Human).
• Sequence Length: 252
• Protein Sequence: MEGHVYWTDDEVWAIRRAYLDGSGAQTLINTKINDPDDIAVNWVARSLYWTHTGTEHIEVTCLNSTSHKILVSEDMDEPRAIALHPEMGLTYWIDWGENPEIKRANLDRQELRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRVHKVKANRDVIIDQLPDLMGLKAVNVDKVVGTNPHADRNGGAATCASSRPTQPGLAAPSRAWNC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
232	Phosphorylation	DRNGGAATCASSRPT CCCCCCCCCCCCCCC	14.20	29083192
235	Phosphorylation	GGAATCASSRPTQPG CCCCCCCCCCCCCCC	29.09	29083192
236	Phosphorylation	GAATCASSRPTQPGL CCCCCCCCCCCCCCC	24.61	29083192
239	Phosphorylation	TCASSRPTQPGLAAP CCCCCCCCCCCCCCC	46.41	29083192

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LRP5L_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LRP5L_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LRP5L_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of LRP5L_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.