UniProt ID | LRC57_RAT | |
---|---|---|
UniProt AC | Q5FVI3 | |
Protein Name | Leucine-rich repeat-containing protein 57 | |
Gene Name | Lrrc57 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 239 | |
Subcellular Localization |
Membrane Lipid-anchor . |
|
Protein Description | ||
Protein Sequence | MGNSALRAHVETAQKTGVFQLKDRGLTEFPSELQKLTSNLRTIDLSNNKIDSLPPLIIGKFTLLKSLSLNNNKLTVLPDELCNLKKLETLSLNNNHLRELPSSFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVVDLSKNQIRSIPDTVGELQAIELNLNQNQISQISVRISCCPRLKVLRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKKFA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGNSALRAH ------CCCHHHHHH | 36.48 | - | |
49 | Ubiquitination | TIDLSNNKIDSLPPL EEECCCCCCCCCCCC | 52.74 | - | |
86 | Acetylation | DELCNLKKLETLSLN HHHHCCCCCCEEECC | 55.51 | 22902405 | |
140 | Ubiquitination | LDVVDLSKNQIRSIP CEEEECCHHHHHCCC | 61.23 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LRC57_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LRC57_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LRC57_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LRC57_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...