| UniProt ID | LRC20_HUMAN | |
|---|---|---|
| UniProt AC | Q8TCA0 | |
| Protein Name | Leucine-rich repeat-containing protein 20 | |
| Gene Name | LRRC20 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 184 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANNELKSLTSKFMTTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPALETINLEENEIVDVPVEKLAAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGARAPLP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 36 | Phosphorylation | LAECKLVSFPIGIYK HHHCEEEEECCHHHH | 35.42 | - | |
| 42 | Phosphorylation | VSFPIGIYKVLRNVS EEECCHHHHHHHHCC | 6.99 | - | |
| 43 | Ubiquitination | SFPIGIYKVLRNVSG EECCHHHHHHHHCCC | 32.64 | 21890473 | |
| 43 | Acetylation | SFPIGIYKVLRNVSG EECCHHHHHHHHCCC | 32.64 | 23236377 | |
| 43 (in isoform 1) | Ubiquitination | - | 32.64 | 21890473 | |
| 43 (in isoform 3) | Ubiquitination | - | 32.64 | 21890473 | |
| 68 | Ubiquitination | ELKSLTSKFMTTFSQ HHHHHHHHHHHHHHH | 33.64 | - | |
| 68 | Acetylation | ELKSLTSKFMTTFSQ HHHHHHHHHHHHHHH | 33.64 | 25953088 | |
| 74 | Phosphorylation | SKFMTTFSQLRELHL HHHHHHHHHHHHHHH | 26.64 | 24719451 | |
| 91 | Phosphorylation | NFLHRLPSEVSALQH CHHHCCCHHHHHHHH | 56.04 | 24719451 | |
| 175 | Phosphorylation | IKFDMLMSPEGARAP EECEEECCCCCCCCC | 18.81 | 27499020 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LRC20_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LRC20_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LRC20_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of LRC20_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
