UniProt ID | LRA25_HUMAN | |
---|---|---|
UniProt AC | Q8N5H3 | |
Protein Name | Leucine repeat adapter protein 25 | |
Gene Name | FAM89B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 189 | |
Subcellular Localization | Isoform 3: Cytoplasm . Cell projection, lamellipodium . Co-localizes with CDC42BPA, CDC42BPB and LIMK1 in the lamellipodium. | |
Protein Description | Negatively regulates TGF-beta-induced signaling; in cooperation with SKI prevents the translocation of SMAD2 from the nucleus to the cytoplasm in response to TGF-beta. Acts as an adapter that mediates the specific recognition of LIMK1 by CDC42BPA and CDC42BPB in the lamellipodia. LRAP25-mediated CDC42BPA/CDC42BPB targeting to LIMK1 and the lamellipodium results in LIMK1 activation and the subsequent phosphorylation of CFL1 which is important for lamellipodial F-actin regulation.. | |
Protein Sequence | MNGLPSAEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAARAPDGPRHAAGAANAGPAAGPRRPVNLDSALAALRKEMVGLRQLDMSLLCQLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNARDQWLQDAFHISL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MNGLPSAEAPGGA --CCCCCCCCCCCCC | - | ||
28 | Phosphorylation | PPLPRGLSGLLNASG CCCCCCHHHHHCCCC | 27251275 | ||
34 | Phosphorylation | LSGLLNASGGSWREL HHHHHCCCCCCHHHH | 28348404 | ||
37 | Phosphorylation | LLNASGGSWRELERV HHCCCCCCHHHHHHH | 28348404 | ||
46 | Phosphorylation | RELERVYSQRSRIHD HHHHHHHHHHHHHHH | - | ||
104 (in isoform 1) | Phosphorylation | - | 28450419 | ||
106 | Phosphorylation | GLRQLDMSLLCQLWG CCHHHCHHHHHHHHH | 23663014 | ||
115 | Phosphorylation | LCQLWGLYESIQDYK HHHHHHHHHHHHHHH | 23663014 | ||
117 | Phosphorylation | QLWGLYESIQDYKHL HHHHHHHHHHHHHHH | 23663014 | ||
121 | Phosphorylation | LYESIQDYKHLCQDL HHHHHHHHHHHHHHH | 23663014 | ||
175 | Phosphorylation | LTVPQTHNARDQWLQ CCCCCCCCCHHHHHH | 20068231 | ||
188 | Phosphorylation | LQDAFHISL------ HHHHHCCCC------ | 20068231 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LRA25_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LRA25_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LRA25_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LRA25_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...